Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus Cobalt transport protein CbiN (cbiN)

This Recombinant Methanothermobacter thermautotrophicus Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

O26234

Expression Region

1-95

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKRHILMLLAVIIISVAPLIIYSGHGEDDGYFGGADDSAGDAITETGYKPWFQPLWEPP SGEIESLLFALQAAIGALIIGYVFGYYRGRGESSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YWHAQ Antibody
KC-30492-01 50 μL

YWHAQ Antibody

Sign In for Pricing
View Details
YWHAQ Antibody
KC-30492-02 100 µL

YWHAQ Antibody

Sign In for Pricing
View Details
YWHAQ Antibody
KC-30492-03 1 mL

YWHAQ Antibody

Sign In for Pricing
View Details
3-(Dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-diethylpropan-1-amine Hydrochloride (E/Z Mixture)
TRC-D418705-500MG 500 mg

3-(Dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-diethylpropan-1-amine Hydrochloride (E/Z Mixture)

Sign In for Pricing
View Details
4-Hydroxymandelic Acid Monohydrate
TRC-H944355-2.5G 2.5 g

4-Hydroxymandelic Acid Monohydrate

Sign In for Pricing
View Details
Ponceau S Solution
#22001 1x 1 L

Ponceau S Solution

Sign In for Pricing
View Details