Recombinant Methanothermobacter thermautotrophicus Cobalt transport protein CbiN (cbiN)
This Recombinant Methanothermobacter thermautotrophicus Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-95.
Product Specifications
Product Name Alternative
Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN
UniProt
O26234
Expression Region
1-95
Origin
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDKRHILMLLAVIIISVAPLIIYSGHGEDDGYFGGADDSAGDAITETGYKPWFQPLWEPP SGEIESLLFALQAAIGALIIGYVFGYYRGRGESSE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH033042-01 10 µg
Recombinant Human SerpinF1/PEDF Protein (His Tag)
Sign In for Pricing
View Details