Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brassica rapa Photosystem I reaction center subunit VI, chloroplastic (PSAH)

This Recombinant Brassica rapa Photosystem I reaction center subunit VI, chloroplastic (PSAH) spans the amino acid sequence from region 51-145.

Product Specifications

Product Name Alternative

Photosystem I reaction center subunit VI, chloroplastic, PSI-H, Light-harvesting complex I 11 kDa protein

UniProt

O04006

Expression Region

51-145

Origin

Brassica rapa (Turnip)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLILG GGSLLTYVSASSTGDVLPIKRGPQEKPKLGPRGKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-100 1x 100 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-100 1x 100 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
BNC400012-100 1x 100 µL

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details