Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthomonas phage phiLf Head virion protein G6P (VI)

This Recombinant Xanthomonas phage phiLf Head virion protein G6P (VI) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Head virion protein G6P, Coat protein D, G6P

UniProt

O55246

Expression Region

1-95

Origin

Xanthomonas phage phiLf (Bacteriophage phi-Lf)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVACGQDGVAGDCRFLGDLFVMWLEQSLSAILYVLTLLPMPDFMKGQSIGGMLGNAGST ILWFADVFMIGPALVMIGAAMIFFLLRRVLTLGIW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-500 1x 500 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-100 1x 100 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Secretory Component / ECM1 (ECM1/2889R), CF568 conjugate, 0.1mg/mL
BNC682889-100 1x 100 µL

Secretory Component / ECM1 (ECM1/2889R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/1766R), CF740 conjugate, 0.1mg/mL
BNC741766-100 1x 100 µL

CD43 (T-Cell Marker) (SPN/1766R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF405S conjugate, 0.1mg/mL
BNC042059-100 1x 100 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF568 conjugate, 0.1mg/mL
BNC681373-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details