Recombinant Uncharacterized protein ML0614 (ML0614)
This Recombinant Uncharacterized protein ML0614 (ML0614) spans the amino acid sequence from region 1-95.
Product Specifications
Product Name Alternative
Uncharacterized protein ML0614
UniProt
Q49760
Expression Region
1-95
Origin
Mycobacterium leprae
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLAFVLQAALVMP VVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6280849-01 0.2 mL
Casc5, CT (Casc5, Knl1, Protein CASC5, Cancer susceptibility candidate gene 5 protein homolog, Kinetochore-null protein 1) (APC)
Sign In for Pricing
View Details MBS6280849-02 5x 0.2 mL
Casc5, CT (Casc5, Knl1, Protein CASC5, Cancer susceptibility candidate gene 5 protein homolog, Kinetochore-null protein 1) (APC)
Sign In for Pricing
View Details 