Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ML0614 (ML0614)

This Recombinant Uncharacterized protein ML0614 (ML0614) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Uncharacterized protein ML0614

UniProt

Q49760

Expression Region

1-95

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLAFVLQAALVMP VVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP8 Antibody
orb2685118-01 50 µL

CASP8 Antibody

Sign In for Pricing
View Details
CASP8 Antibody
orb2685118-02 100 µL

CASP8 Antibody

Sign In for Pricing
View Details
CASP8 Antibody
orb2685118-03 200 µL

CASP8 Antibody

Sign In for Pricing
View Details
Mouse Apolipoprotein E ELISA Kit
MBS009534-01 48 Well

Mouse Apolipoprotein E ELISA Kit

Sign In for Pricing
View Details
Mouse Apolipoprotein E ELISA Kit
MBS009534-02 96 Well

Mouse Apolipoprotein E ELISA Kit

Sign In for Pricing
View Details
Mouse Apolipoprotein E ELISA Kit
MBS009534-03 5x 96 Well

Mouse Apolipoprotein E ELISA Kit

Sign In for Pricing
View Details