Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqzJ (yqzJ)

This Recombinant Bacillus subtilis Uncharacterized protein yqzJ (yqzJ) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Uncharacterized protein yqzJ

UniProt

Q7WY64

Expression Region

1-95

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTMFVESINDVLFLVDFFTIILPALTAIGIAFLLRECRAGEQWKSKRTDEHQTVFHINRT DFLIIIYHRITTWIRKVFRMNSPVNDEEDAGSLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBFOX2 (NM_001031695) Human Recombinant Protein
TP306846 20 µg

RBFOX2 (NM_001031695) Human Recombinant Protein

Sign In for Pricing
View Details
Human TLR7 activation kit by CRISPRa
GA109704 1 Kit

Human TLR7 activation kit by CRISPRa

Sign In for Pricing
View Details
LRSAM1 (NM_001005373) Human Over-expression Lysate
LC423706 20 µg

LRSAM1 (NM_001005373) Human Over-expression Lysate

Sign In for Pricing
View Details
Saliva RNA Collection and Preservation Devices
RU53800 50 Units

Saliva RNA Collection and Preservation Devices

Sign In for Pricing
View Details
4-Bromo-2,6-diisopropylaniline
TRC-B683730-5G 5 g

4-Bromo-2,6-diisopropylaniline

Sign In for Pricing
View Details
2-Oxo-2,3-dihydro-1H-1,3-benzodiazole-5-carbaldehyde
TRC-O990210-500MG 500 mg

2-Oxo-2,3-dihydro-1H-1,3-benzodiazole-5-carbaldehyde

Sign In for Pricing
View Details