Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqzJ (yqzJ)

This Recombinant Bacillus subtilis Uncharacterized protein yqzJ (yqzJ) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Uncharacterized protein yqzJ

UniProt

Q7WY64

Expression Region

1-95

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTMFVESINDVLFLVDFFTIILPALTAIGIAFLLRECRAGEQWKSKRTDEHQTVFHINRT DFLIIIYHRITTWIRKVFRMNSPVNDEEDAGSLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit IgG (Fab Fragment specific), AlpSdAbs® VHH
HA710050 100 µg

Rabbit IgG (Fab Fragment specific), AlpSdAbs® VHH

Sign In for Pricing
View Details
GFP, AlpHcAbs® Mouse
HA710232 100 µg

GFP, AlpHcAbs® Mouse

Sign In for Pricing
View Details
PKC delta (PRKCD) Human Knockdown Lysate
LY300279 100 µg

PKC delta (PRKCD) Human Knockdown Lysate

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032UM1-02 100 µg

Elab Fluor® 700 Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
B3GALTL Antibody
8C14717-AAT 50 µg

B3GALTL Antibody

Sign In for Pricing
View Details