Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqzJ (yqzJ)

This Recombinant Bacillus subtilis Uncharacterized protein yqzJ (yqzJ) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Uncharacterized protein yqzJ

UniProt

Q7WY64

Expression Region

1-95

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTMFVESINDVLFLVDFFTIILPALTAIGIAFLLRECRAGEQWKSKRTDEHQTVFHINRT DFLIIIYHRITTWIRKVFRMNSPVNDEEDAGSLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRCH4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F8]
TA505246BM 100 µL

LRCH4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F8]

Sign In for Pricing
View Details
Necdin (NDN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B1]
TA506977AM 100 µL

Necdin (NDN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B1]

Sign In for Pricing
View Details
Dlk1 Rat Monoclonal Antibody [Clone ID: 24-11]
AM26511RP-N 50 Tests

Dlk1 Rat Monoclonal Antibody [Clone ID: 24-11]

Sign In for Pricing
View Details
Prxl2c Mouse Gene Knockout Kit (CRISPR)
KN500580 1 Kit

Prxl2c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), 0.2mg/mL
BNUB0149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), 0.2mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS711640 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details