Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yebO (yebO)

This Recombinant Uncharacterized protein yebO (yebO) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Uncharacterized protein yebO

UniProt

Q8XCN8

Expression Region

1-95

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEVVNSGVMNIASLVVSVVVLLIGLILWFFINRASSRTNEQIELLEALLDQQKRQNALL RRLCEANEPEKADKKTIESQKSVEDEDIIRLVAER

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Osteoprotegerin Ligand (OPGL) ELISA Kit
QY-E21121 96 Tests

Mouse Osteoprotegerin Ligand (OPGL) ELISA Kit

Sign In for Pricing
View Details
CD16 Mouse Monoclonal Antibody
TD-31387 100 µL

CD16 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
MIB1 Antibody, FITC conjugated
A45270-100UG 100 µg

MIB1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Mouse IL-21R non-lytic Recombinant Protein Fc Tag Lyophilized
MBS8434174 Inquire

Mouse IL-21R non-lytic Recombinant Protein Fc Tag Lyophilized

Sign In for Pricing
View Details
C3AR1 Antibody - C-terminal region
ARP60073_P050-25UL 25 µL

C3AR1 Antibody - C-terminal region

Sign In for Pricing
View Details
Tri-iodothyronine (T3) Porcine ELISA Kit
H8778 96 Tests

Tri-iodothyronine (T3) Porcine ELISA Kit

Sign In for Pricing
View Details