Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yebO (yebO)

This Recombinant Uncharacterized protein yebO (yebO) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Uncharacterized protein yebO

UniProt

Q8XCN8

Expression Region

1-95

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEVVNSGVMNIASLVVSVVVLLIGLILWFFINRASSRTNEQIELLEALLDQQKRQNALL RRLCEANEPEKADKKTIESQKSVEDEDIIRLVAER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human IVD shRNA (UAS) - Lentiviral human IVD shRNA (UAS, iRFP) (100)
GTR15326250 1 Vial

Lentiviral human IVD shRNA (UAS) - Lentiviral human IVD shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
GLRX2 Knockout 786-O Polyclonal Cells
ARG5736 1 Million

GLRX2 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
GTF3C5 Antibody
orb417563-01 50 µg

GTF3C5 Antibody

Sign In for Pricing
View Details
GTF3C5 Antibody
orb417563-02 100 µg

GTF3C5 Antibody

Sign In for Pricing
View Details
1700007K13Rik Mouse siRNA Oligo Duplex (Locus ID 69327)
SR403823 1 Kit

1700007K13Rik Mouse siRNA Oligo Duplex (Locus ID 69327)

Sign In for Pricing
View Details
OAAF06975-100UG - PRKX Antibody
OAAF06975-100UG 100 µg

OAAF06975-100UG - PRKX Antibody

Sign In for Pricing
View Details