Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein encoded by LINC00301 (LINC00301)

This Recombinant Human Putative uncharacterized protein encoded by LINC00301 (LINC00301) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Putative uncharacterized protein encoded by LINC00301

UniProt

Q8NCQ3

Expression Region

1-95

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSSHIVLKEETRMLGLMYAIWMNLNSFGLAIIGILLIACEIILFLTKDETIQWPHVPSN RGSKANLILKELQLLVRSTWWFHRETAQRTCLYLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MyoGEF (PLEKHG6) (NM_001144857) Human Over-expression Lysate
LC428529 20 µg

MyoGEF (PLEKHG6) (NM_001144857) Human Over-expression Lysate

Sign In for Pricing
View Details
MHC Class II RT1D Mouse Monoclonal Antibody [Clone ID: OX-17]
CL121FX 500 µg

MHC Class II RT1D Mouse Monoclonal Antibody [Clone ID: OX-17]

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3294), CF640R conjugate, 0.1mg/mL
BNC403294-500 1x 500 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3294), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SNRPB2 Mouse Monoclonal Antibody [Clone ID: OTI2A5]
CF808140 100 µg

SNRPB2 Mouse Monoclonal Antibody [Clone ID: OTI2A5]

Sign In for Pricing
View Details
MAG (NM_002361) Human Over-expression Lysate
LC419374 20 µg

MAG (NM_002361) Human Over-expression Lysate

Sign In for Pricing
View Details
NFYC Antibody
8C17136-AAT 50 µg

NFYC Antibody

Sign In for Pricing
View Details