Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein encoded by LINC00301 (LINC00301)

This Recombinant Human Putative uncharacterized protein encoded by LINC00301 (LINC00301) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Putative uncharacterized protein encoded by LINC00301

UniProt

Q8NCQ3

Expression Region

1-95

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSSHIVLKEETRMLGLMYAIWMNLNSFGLAIIGILLIACEIILFLTKDETIQWPHVPSN RGSKANLILKELQLLVRSTWWFHRETAQRTCLYLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nlrp12 Mouse Gene Knockout Kit (CRISPR)
KN311043LP 1 Kit

Nlrp12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MTLN activation kit by CRISPRa
GA116461 1 Kit

Human MTLN activation kit by CRISPRa

Sign In for Pricing
View Details
C Reactive Protein (CRP) Mouse Monoclonal Antibody [Clone ID: OTI4G8]
CF807723 100 µg

C Reactive Protein (CRP) Mouse Monoclonal Antibody [Clone ID: OTI4G8]

Sign In for Pricing
View Details
Tlr6 (N-term) Rabbit Polyclonal Antibody
AP11537PU-N 400 µL

Tlr6 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RTL4 (NM_001004308) Human Over-expression Lysate
LY424084 100 µg

RTL4 (NM_001004308) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IgE, AlpSdAbs® VHH
HA710275 100 µg

Human IgE, AlpSdAbs® VHH

Sign In for Pricing
View Details