Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukocyte-specific transcript 1 protein (Lst1)

This Recombinant Mouse Leukocyte-specific transcript 1 protein (Lst1) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Leukocyte-specific transcript 1 protein, Protein B144

UniProt

O08843

Expression Region

1-95

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDDNGSGNNCTTNHFLLYGSLGLGGLLLLLVIILFICLCGFSQRVKRLERNAQVSGQEP HYASLQQLPVSSSDITDMKEDLSTDYACIARSTPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC_Cy7 Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)
MBS2129908-01 0.1 mL

APC_Cy7 Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)
MBS2129908-02 0.2 mL

APC_Cy7 Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)
MBS2129908-03 0.5 mL

APC_Cy7 Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)
MBS2129908-04 1 mL

APC_Cy7 Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)
MBS2129908-05 5 mL

APC_Cy7 Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)
MBS2129908-06 5x 5 mL

APC_Cy7 Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing
View Details