Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukocyte-specific transcript 1 protein (Lst1)

This Recombinant Mouse Leukocyte-specific transcript 1 protein (Lst1) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Leukocyte-specific transcript 1 protein, Protein B144

UniProt

O08843

Expression Region

1-95

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDDNGSGNNCTTNHFLLYGSLGLGGLLLLLVIILFICLCGFSQRVKRLERNAQVSGQEP HYASLQQLPVSSSDITDMKEDLSTDYACIARSTPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement 4d Antibody / C4d
V9091-20UG 20 µg

Complement 4d Antibody / C4d

Sign In for Pricing
View Details
GDPGP1 (NM_001013657) Human Over-expression Lysate
LS390637-20ug 20 µg

GDPGP1 (NM_001013657) Human Over-expression Lysate

Sign In for Pricing
View Details
TBC1D9B 3'UTR Luciferase Stable Cell Line
TU025202 1.0 mL

TBC1D9B 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ENG Antibody
orb685913-01 50 μL

ENG Antibody

Sign In for Pricing
View Details
ENG Antibody
orb685913-02 100 µL

ENG Antibody

Sign In for Pricing
View Details
Rabbit anti-golgiapparatusantibody (AGAA) ELISA Kit
MBS2602084-01 48 Well

Rabbit anti-golgiapparatusantibody (AGAA) ELISA Kit

Sign In for Pricing
View Details