Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gomphosus varius Cytochrome b (mt-cyb)

This Recombinant Gomphosus varius Cytochrome b (mt-cyb) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

UniProt

P29666

Expression Region

1-95

Origin

Gomphosus varius (Bird wrasse) (Gomphosus tricolor)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLCLASQLLTGLFLAMHYTSDIATAFSSVAHICRDVNYGWLIRNMHANGASFFFICIYLH IGRGLYYGSYLYKETWNIGVVLLLLVMMTAFVGYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sema6c activation kit by CRISPRa
GA203844 1 Kit

Mouse Sema6c activation kit by CRISPRa

Sign In for Pricing
View Details
Human AKAIN1 activation kit by CRISPRa
GA118666 1 Kit

Human AKAIN1 activation kit by CRISPRa

Sign In for Pricing
View Details
ST5 Antibody
8C10797-AAT 50 µg

ST5 Antibody

Sign In for Pricing
View Details
2,5-Anhydro-3,4-dibenzyl-D-glucitol
TRC-A637850-25MG 25 mg

2,5-Anhydro-3,4-dibenzyl-D-glucitol

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS521364 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS711181 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details