Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gomphosus varius Cytochrome b (mt-cyb)

This Recombinant Gomphosus varius Cytochrome b (mt-cyb) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

UniProt

P29666

Expression Region

1-95

Origin

Gomphosus varius (Bird wrasse) (Gomphosus tricolor)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLCLASQLLTGLFLAMHYTSDIATAFSSVAHICRDVNYGWLIRNMHANGASFFFICIYLH IGRGLYYGSYLYKETWNIGVVLLLLVMMTAFVGYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat LRP1 (Low Density Lipoprotein Receptor Related Protein 1) ELISA Kit
EK251348 96 Well

Rat LRP1 (Low Density Lipoprotein Receptor Related Protein 1) ELISA Kit

Sign In for Pricing
View Details
Ethyl (4-nitrophenyl) acetate
FE22926-01 50 g

Ethyl (4-nitrophenyl) acetate

Sign In for Pricing
View Details
Ethyl (4-nitrophenyl) acetate
FE22926-02 100 g

Ethyl (4-nitrophenyl) acetate

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-1912-3p Vector
mm30223 500 ng

LentimiRa-Off-mmu-miR-1912-3p Vector

Sign In for Pricing
View Details
SMARCD1 Rabbit mAb
MBS8604088-01 0.1 mL

SMARCD1 Rabbit mAb

Sign In for Pricing
View Details
SMARCD1 Rabbit mAb
MBS8604088-02 0.1 mL (AF405L)

SMARCD1 Rabbit mAb

Sign In for Pricing
View Details