Recombinant Gomphosus varius Cytochrome b (mt-cyb)
This Recombinant Gomphosus varius Cytochrome b (mt-cyb) spans the amino acid sequence from region 1-95.
Product Specifications
Product Name Alternative
Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit
UniProt
P29666
Expression Region
1-95
Origin
Gomphosus varius (Bird wrasse) (Gomphosus tricolor)
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
GLCLASQLLTGLFLAMHYTSDIATAFSSVAHICRDVNYGWLIRNMHANGASFFFICIYLH IGRGLYYGSYLYKETWNIGVVLLLLVMMTAFVGYV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6131685-01 0.1 mL
HLA-DMA (HLA Class II Histocompatibility Antigen, DM alpha Chain, MHC Class II Antigen DMA, Really Interesting New Gene 6 Protein, DMA, RING6) (AP)
Sign In for Pricing
View Details MBS6131685-02 5x 0.1 mL
HLA-DMA (HLA Class II Histocompatibility Antigen, DM alpha Chain, MHC Class II Antigen DMA, Really Interesting New Gene 6 Protein, DMA, RING6) (AP)
Sign In for Pricing
View Details 
MBS6473763-01 0.2 mL
ELOVL6, NT (Elongation of Very Long Chain Fatty Acids Protein 6, Fatty Acid Elongase 2, hELO2, Fatty Acyl-CoA Elongase, Long-chain Fatty-acyl Elongase, LCE, FACE) (Biotin)
Sign In for Pricing
View Details