Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywkF (ywkF)

This Recombinant Bacillus subtilis Uncharacterized protein ywkF (ywkF) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Uncharacterized protein ywkF

UniProt

P45874

Expression Region

1-95

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKALTAGILLIAIESMIGTIFPQALSYEAIFGVASLVLVGLAIITSGLAVSGSDQRANY HSETKEGRTSRMKMAAAFFVAAIPSILCYLLTILF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Transmembrane Protease, Serine 2 (TMPRSS2) ELISA Kit
DLR-TMPRSS2-Mu-96T 96 Tests

Mouse Transmembrane Protease, Serine 2 (TMPRSS2) ELISA Kit

Sign In for Pricing
View Details
TMEM59 Polyclonal Antibody
CAC14968-01 50 µg

TMEM59 Polyclonal Antibody

Sign In for Pricing
View Details
TMEM59 Polyclonal Antibody
CAC14968-02 100 µg

TMEM59 Polyclonal Antibody

Sign In for Pricing
View Details
Mycoplasma pneumoniae PCR kit
PCR-M402-48D 50T

Mycoplasma pneumoniae PCR kit

Sign In for Pricing
View Details
DCUN1D2 Antibody
A58775-100UG 100 µg

DCUN1D2 Antibody

Sign In for Pricing
View Details
Recombinant Human Tubulin Folding Cofactor E-Like
MBS146328-01 0.005 mg

Recombinant Human Tubulin Folding Cofactor E-Like

Sign In for Pricing
View Details