Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywkF (ywkF)

This Recombinant Bacillus subtilis Uncharacterized protein ywkF (ywkF) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Uncharacterized protein ywkF

UniProt

P45874

Expression Region

1-95

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKALTAGILLIAIESMIGTIFPQALSYEAIFGVASLVLVGLAIITSGLAVSGSDQRANY HSETKEGRTSRMKMAAAFFVAAIPSILCYLLTILF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RS 79948 hydrochloride
B6534-50 50 mg

RS 79948 hydrochloride

Sign In for Pricing
View Details
C17ORF47 Protein Lysate
OCOA15779-20UG 20 µg

C17ORF47 Protein Lysate

Sign In for Pricing
View Details
Human PYURF knockout cell line
ABC-KH12497 1 Vial

Human PYURF knockout cell line

Sign In for Pricing
View Details
TREX1 Peptide
MBS544612-01 0.25 mg

TREX1 Peptide

Sign In for Pricing
View Details
TREX1 Peptide
MBS544612-02 5x 0.25 mg

TREX1 Peptide

Sign In for Pricing
View Details
TMEM216 (NM_016499) Human Over-expression Lysate
LH10121V 100 µg

TMEM216 (NM_016499) Human Over-expression Lysate

Sign In for Pricing
View Details