Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ynxB (ynxB)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ynxB (ynxB) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ynxB

UniProt

P31844

Expression Region

1-96

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKLTIFSGGLGAVFSVLAQLFAVIDDSYTLGNLWFLGALAGIITMLASIQTNNKPVFSI LLIASSVIGLLGTGLVYIIPTLFNIIIIYKFSKVSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta Amyloid 1-42 Antibody
KC-106-01 50 μL

Beta Amyloid 1-42 Antibody

Sign In for Pricing
View Details
Beta Amyloid 1-42 Antibody
KC-106-02 100 µL

Beta Amyloid 1-42 Antibody

Sign In for Pricing
View Details
Beta Amyloid 1-42 Antibody
KC-106-03 1 mL

Beta Amyloid 1-42 Antibody

Sign In for Pricing
View Details
PLC β3 (Ab-537) Antibody
8B0722-AAT 50 µg

PLC β3 (Ab-537) Antibody

Sign In for Pricing
View Details
GFAP (ASTRO/789), CF640R conjugate, 0.1mg/mL
BNC400789-100 1x 100 µL

GFAP (ASTRO/789), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
6,8-Dichlorooctanoic Acid Ethyl Ester
TRC-D435555-10G 10 g

6,8-Dichlorooctanoic Acid Ethyl Ester

Sign In for Pricing
View Details