Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ynxB (ynxB)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ynxB (ynxB) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ynxB

UniProt

P31844

Expression Region

1-96

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKLTIFSGGLGAVFSVLAQLFAVIDDSYTLGNLWFLGALAGIITMLASIQTNNKPVFSI LLIASSVIGLLGTGLVYIIPTLFNIIIIYKFSKVSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF4 Mouse Monoclonal Antibody [Clone ID: 1E5]
AM06490SU-N 100 µL

KLF4 Mouse Monoclonal Antibody [Clone ID: 1E5]

Sign In for Pricing
View Details
B4GALNT4 Mouse Monoclonal Antibody [Clone ID: OTI1H1]
CF816147 100 µg

B4GALNT4 Mouse Monoclonal Antibody [Clone ID: OTI1H1]

Sign In for Pricing
View Details
Recombinant Human OX40/TNFRSF4 Protein (Fc Tag)
PKSH032843-01 10 µg

Recombinant Human OX40/TNFRSF4 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human OX40/TNFRSF4 Protein (Fc Tag)
PKSH032843-02 50 µg

Recombinant Human OX40/TNFRSF4 Protein (Fc Tag)

Sign In for Pricing
View Details
TMEM223 Human Gene Knockout Kit (CRISPR)
KN422037 1 Kit

TMEM223 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DDX5 Human Knockdown Lysate
LY300134 100 µg

DDX5 Human Knockdown Lysate

Sign In for Pricing
View Details