Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0189 (AF_0189)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0189 (AF_0189) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0189

UniProt

O30049

Expression Region

1-96

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTHQCHIIRAVPVVRYVVALLHWLLWRVVVIIAISVPVFHHPFRNLRPCHFRPSWVCNR ILRTSSFPMVLPSQHRALPSHQHQHYANLLPIHFTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAP1 (BRCA1 Associated Protein 1) (BAP1/2431), 0.2mg/mL
BNUB2431-100 1x 100 µL

BAP1 (BRCA1 Associated Protein 1) (BAP1/2431), 0.2mg/mL

Sign In for Pricing
View Details
1,1,1-Trifluoro-2-iodoethane
TRC-T790400-5G 5 g

1,1,1-Trifluoro-2-iodoethane

Sign In for Pricing
View Details
ASC 2 (NCOA6) Human Gene Knockout Kit (CRISPR)
KN417698 1 Kit

ASC 2 (NCOA6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human H10 (H1F0) activation kit by CRISPRa
GA102043 1 Kit

Human H10 (H1F0) activation kit by CRISPRa

Sign In for Pricing
View Details
GLDC Human Gene Knockout Kit (CRISPR)
KN211292 1 Kit

GLDC Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
gamma Adducin (ADD3) Human Gene Knockout Kit (CRISPR)
KN209129LP 1 Kit

gamma Adducin (ADD3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details