Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0189 (AF_0189)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0189 (AF_0189) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0189

UniProt

O30049

Expression Region

1-96

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTHQCHIIRAVPVVRYVVALLHWLLWRVVVIIAISVPVFHHPFRNLRPCHFRPSWVCNR ILRTSSFPMVLPSQHRALPSHQHQHYANLLPIHFTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCR Tubes
PC0201-DCP-N 10000 Tubes/Pack

PCR Tubes

Sign In for Pricing
View Details
16S V4 Library Preparation Kit for Illumina (Set A)
70610 96 Preparations

16S V4 Library Preparation Kit for Illumina (Set A)

Sign In for Pricing
View Details
DDAH2 Human Gene Knockout Kit (CRISPR)
KN400287 1 Kit

DDAH2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EDF1 (NM_001281298) Human Tagged ORF Clone
RG235847 10 µg

EDF1 (NM_001281298) Human Tagged ORF Clone

Sign In for Pricing
View Details
Antizyme inhibitor 1 (AZIN1) Human Gene Knockout Kit (CRISPR)
KN400022 1 Kit

Antizyme inhibitor 1 (AZIN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Pfdn5 activation kit by CRISPRa
GA206036 1 Kit

Mouse Pfdn5 activation kit by CRISPRa

Sign In for Pricing
View Details