Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ydzA (ydzA)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ydzA (ydzA) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ydzA

UniProt

O31485

Expression Region

1-96

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHTPIGRLRTMGFIEGMSLLILLFIAMPLKYWAGLPLAVTIVGSVHGGLFILYLLVLAY ATFSVKWPLKWSAAGFIAAFVPFGNFLYDRGLRNYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD24 Protein Vector (Human) (pPM-C-His)
PV062332 500 ng

ANKRD24 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal Kallikrein 7 Antibody (MM0433-5J28) [DyLight 594]
NBP2-11753DL594 0.1 mL

Mouse Monoclonal Kallikrein 7 Antibody (MM0433-5J28) [DyLight 594]

Sign In for Pricing
View Details
TMEM158 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
46921124 3x 1.0µg DNA

TMEM158 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
CAMK2D Human shRNA Plasmid Kit (Locus ID 817)
TF320284 1 Kit

CAMK2D Human shRNA Plasmid Kit (Locus ID 817)

Sign In for Pricing
View Details
GGTLC1 (GGTLA4, Gamma-glutamyltransferase Light Chain 1, Gamma-glutamyltransferase-like Activity 4, Gamma-glutamyltransferase-like Protein 6, dJ831C21.1, dJ831C21.2, MGC50550) (HRP)
137990-HRP 100 µL

GGTLC1 (GGTLA4, Gamma-glutamyltransferase Light Chain 1, Gamma-glutamyltransferase-like Activity 4, Gamma-glutamyltransferase-like Protein 6, dJ831C21.1, dJ831C21.2, MGC50550) (HRP)

Sign In for Pricing
View Details
ELISA Kit For E3 ubiquitin-protein ligase TRIM21
E0290h 96 Tests

ELISA Kit For E3 ubiquitin-protein ligase TRIM21

Sign In for Pricing
View Details