Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yvlD (yvlD)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yvlD (yvlD) spans the amino acid sequence from region 24-119.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yvlD

UniProt

O34648

Expression Region

24-119

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SIHISSIGAAIIASLILSILNVLIKPLLIIFTLPVTMVTLGLFLFVINAITLMMTASIMG DSFQIDGFGTAIWASVILSVFHLLIQKGILEPLRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Androst-3-en-17-one
TRC-A638045-10MG 10 mg

Androst-3-en-17-one

Sign In for Pricing
View Details
Deoxypyridinoline Chloride Trihydrochloride Salt
TRC-D249900-10MG 10 mg

Deoxypyridinoline Chloride Trihydrochloride Salt

Sign In for Pricing
View Details
Hexylcaine Hydrochloride
TRC-H295690-2.5G 2.5 g

Hexylcaine Hydrochloride

Sign In for Pricing
View Details
Recombinant Mouse VEGFR2 Protein (His Tag)
PDMM100104-01 20 µg

Recombinant Mouse VEGFR2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse VEGFR2 Protein (His Tag)
PDMM100104-02 100 µg

Recombinant Mouse VEGFR2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse VEGFR2 Protein (His Tag)
PDMM100104-03 500 µg

Recombinant Mouse VEGFR2 Protein (His Tag)

Sign In for Pricing
View Details