Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD)
This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.
Product Specifications
Product Name Alternative
Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV
UniProt
Q2FZK2
Expression Region
1-96
Origin
Staphylococcus aureus (strain NCTC 8325)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS619209-01 0.1 mg
Raptor, phosphorylated (Ser706) (Regulatory Associated Protein of mTOR, p150 Target of Rapamycin (TOR) Scaffold Protein containing WD-repeats, KIAA1303)
Sign In for Pricing
View Details MBS619209-02 5x 0.1 mg
Raptor, phosphorylated (Ser706) (Regulatory Associated Protein of mTOR, p150 Target of Rapamycin (TOR) Scaffold Protein containing WD-repeats, KIAA1303)
Sign In for Pricing
View Details