Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q2FZK2

Expression Region

1-96

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse ZNF3 (KIAA4229), Rabbit Polyclonal
MKA4229 Inquire

Anti-Mouse ZNF3 (KIAA4229), Rabbit Polyclonal

Sign In for Pricing
View Details
RPS26P17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2049907 1.0 µg DNA

RPS26P17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Snap91 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7116503 1.0 µg DNA

Snap91 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Plant MDM2 p53 Binding Protein Homolog (MDM2) ELISA Kit
MBS9378573 Inquire

Plant MDM2 p53 Binding Protein Homolog (MDM2) ELISA Kit

Sign In for Pricing
View Details
PECMV-Msrb1-m-FLAG
BZ16276 1 Vial

PECMV-Msrb1-m-FLAG

Sign In for Pricing
View Details
6-TAMRA cadaverine
HY-172284 1 Each

6-TAMRA cadaverine

Sign In for Pricing
View Details