Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q2FZK2

Expression Region

1-96

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCC3 Antibody, FITC conjugated
A14194-50UG 50 µg

BRCC3 Antibody, FITC conjugated

Sign In for Pricing
View Details
Nadk2 Mouse shRNA Plasmid (Locus ID 68646)
TR504186 1 Kit

Nadk2 Mouse shRNA Plasmid (Locus ID 68646)

Sign In for Pricing
View Details
Cysltr1 (NM_001281859) Mouse Untagged Clone
MC227223 10 µg

Cysltr1 (NM_001281859) Mouse Untagged Clone

Sign In for Pricing
View Details
CHTF8 Recombinant Protein Antigen
NBP2-56494PEP 100 µL

CHTF8 Recombinant Protein Antigen

Sign In for Pricing
View Details
PNKD Protein Lysate (Mouse) with C-HA Tag
37092035 100 µg

PNKD Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Human Neutrophil defensin 1 (HNP-1) ELISA Kit
orb2811317-01 48 Tests

Human Neutrophil defensin 1 (HNP-1) ELISA Kit

Sign In for Pricing
View Details