Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q2FI20

Expression Region

1-96

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD34A Recombinant Protein (Mouse)
RP115934 100 µg

ANKRD34A Recombinant Protein (Mouse)

Sign In for Pricing
View Details
SLC10A1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-1958R-BF350-TR 20 µL

SLC10A1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Sheep beta-Catenin ELISA Kit
MBS028494-01 48 Well

Sheep beta-Catenin ELISA Kit

Sign In for Pricing
View Details
Sheep beta-Catenin ELISA Kit
MBS028494-02 96 Well

Sheep beta-Catenin ELISA Kit

Sign In for Pricing
View Details
Sheep beta-Catenin ELISA Kit
MBS028494-03 5x 96 Well

Sheep beta-Catenin ELISA Kit

Sign In for Pricing
View Details
Sheep beta-Catenin ELISA Kit
MBS028494-04 10x 96 Well

Sheep beta-Catenin ELISA Kit

Sign In for Pricing
View Details