Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q2FI20

Expression Region

1-96

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK3B Protein (N-His, Human)
P504389 100 µg

GSK3B Protein (N-His, Human)

Sign In for Pricing
View Details
Mouse Monoclonal MFG-E8 Antibody (EDM45) [DyLight 650]
NBP2-47813C 0.1 mL

Mouse Monoclonal MFG-E8 Antibody (EDM45) [DyLight 650]

Sign In for Pricing
View Details
Recombinant Human GRIPAP1 Protein
E30P62027A 50 µg

Recombinant Human GRIPAP1 Protein

Sign In for Pricing
View Details
4- (3,5-Dimethyl-1H-pyrazol-1-yl) -2- (trifluoromethyl) benzonitrile
CWB57417-01 0.5 g

4- (3,5-Dimethyl-1H-pyrazol-1-yl) -2- (trifluoromethyl) benzonitrile

Sign In for Pricing
View Details
4- (3,5-Dimethyl-1H-pyrazol-1-yl) -2- (trifluoromethyl) benzonitrile
CWB57417-02 5 g

4- (3,5-Dimethyl-1H-pyrazol-1-yl) -2- (trifluoromethyl) benzonitrile

Sign In for Pricing
View Details
PRNP Rabbit pAb, PE-Cy7 conjugated
orb2877333 100 µL

PRNP Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details