Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Colicin-K immunity protein (cki)

This Recombinant Colicin-K immunity protein (cki) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Colicin-K immunity protein

UniProt

Q47503

Expression Region

1-96

Origin

Escherichia coli

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHLKYYLHNLPESLIPWILILIFNDNDNTPLLFIFISSIHVLLYPYSKLTISRYIKENTK LKKEPWYLCKLSALFYLLMAIPVGLPSFIYYTLKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Bone Sialoprotein 2/IBSP Protein (His Tag)
PKSM041355-01 10 µg

Recombinant Mouse Bone Sialoprotein 2/IBSP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Bone Sialoprotein 2/IBSP Protein (His Tag)
PKSM041355-02 50 µg

Recombinant Mouse Bone Sialoprotein 2/IBSP Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB527902 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Serpinb2 Rabbit Polyclonal Antibody
TA363091 100 µL

Serpinb2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human VEGFR-2/KDR Antibody Pair Set
E-KAB-0472 50 µL & 100 µg

Human VEGFR-2/KDR Antibody Pair Set

Sign In for Pricing
View Details
Human HtrA Serine Peptidase 4 (HTRA4) ELISA Kit
RD-HTRA4-Hu-01 96 Tests

Human HtrA Serine Peptidase 4 (HTRA4) ELISA Kit

Sign In for Pricing
View Details