Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Colicin-K immunity protein (cki)

This Recombinant Colicin-K immunity protein (cki) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Colicin-K immunity protein

UniProt

Q47503

Expression Region

1-96

Origin

Escherichia coli

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHLKYYLHNLPESLIPWILILIFNDNDNTPLLFIFISSIHVLLYPYSKLTISRYIKENTK LKKEPWYLCKLSALFYLLMAIPVGLPSFIYYTLKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cortisol-1,2-d2
TRC-H714616-5MG 5 mg

Cortisol-1,2-d2

Sign In for Pricing
View Details
PLCG 2 (PLCG2) Human Gene Knockout Kit (CRISPR)
KN400442 1 Kit

PLCG 2 (PLCG2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Napsin-A (NAPSA/1239), CF405S conjugate, 0.1mg/mL
BNC041239-500 1x 500 µL

Napsin-A (NAPSA/1239), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RPS3 (NM_001005) Human Over-expression Lysate
LC423944 20 µg

RPS3 (NM_001005) Human Over-expression Lysate

Sign In for Pricing
View Details
GMNN Polyclonal Antibody
E-AB-60894-01 60 µL

GMNN Polyclonal Antibody

Sign In for Pricing
View Details
GMNN Polyclonal Antibody
E-AB-60894-02 120 µL

GMNN Polyclonal Antibody

Sign In for Pricing
View Details