Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Colicin-K immunity protein (cki)

This Recombinant Colicin-K immunity protein (cki) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Colicin-K immunity protein

UniProt

Q47503

Expression Region

1-96

Origin

Escherichia coli

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHLKYYLHNLPESLIPWILILIFNDNDNTPLLFIFISSIHVLLYPYSKLTISRYIKENTK LKKEPWYLCKLSALFYLLMAIPVGLPSFIYYTLKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCC1 Recombinant Rabbit Monoclonal Antibody [JE39-10]
HA722311 100 µL

RCC1 Recombinant Rabbit Monoclonal Antibody [JE39-10]

Sign In for Pricing
View Details
RAB1A Antibody: APC
SMC-612D-APC 100 µg

RAB1A Antibody: APC

Sign In for Pricing
View Details
Griffonia simplicifolia Gel -GS-II- Immobilized Lectin
AK-2402-2 2 mL

Griffonia simplicifolia Gel -GS-II- Immobilized Lectin

Sign In for Pricing
View Details
LCK Rabbit Monoclonal Antibody [Clone ID: R01-8A5]
TA421533 100 µL

LCK Rabbit Monoclonal Antibody [Clone ID: R01-8A5]

Sign In for Pricing
View Details
PHKG1 (NM_006213) Human Recombinant Protein
TP308591M 100 µg

PHKG1 (NM_006213) Human Recombinant Protein

Sign In for Pricing
View Details
TentaGel® HL CHO
HL12136.25G 25 g

TentaGel® HL CHO

Sign In for Pricing
View Details