Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q49WI1

Expression Region

1-96

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTIVKHTVGFIASIVLTILAVFVTLYTSMALNAKITIIFGFAFIQAAVQLLMFMHLTES KDGNLQTFKVLFAIIITLITVIGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Calcineurin A Antibody [FITC]
NB110-40553F 0.1 mL

Rabbit Polyclonal Calcineurin A Antibody [FITC]

Sign In for Pricing
View Details
SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (PE)
MBS6161464-01 0.1 mL

SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (PE)

Sign In for Pricing
View Details
SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (PE)
MBS6161464-02 5x 0.1 mL

SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (PE)

Sign In for Pricing
View Details
Faralimomab Biosimilar - Research Grade
ICH5543-1mg 1 mg

Faralimomab Biosimilar - Research Grade

Sign In for Pricing
View Details
Slc40a1 3'UTR GFP Stable Cell Line
TU169141 1.0 mL

Slc40a1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TBPL1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61528R-BF750-01 20 µL

TBPL1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details