Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q49WI1

Expression Region

1-96

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTIVKHTVGFIASIVLTILAVFVTLYTSMALNAKITIIFGFAFIQAAVQLLMFMHLTES KDGNLQTFKVLFAIIITLITVIGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Oxyntomodulin (OXM), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0032109 96 Tests

Multiplex Assay Kit for Oxyntomodulin (OXM), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
C-C Motif Chemokine 27 (CCL27) Antibody
abx171967-01 100 µL

C-C Motif Chemokine 27 (CCL27) Antibody

Sign In for Pricing
View Details
C-C Motif Chemokine 27 (CCL27) Antibody
abx171967-02 200 µL

C-C Motif Chemokine 27 (CCL27) Antibody

Sign In for Pricing
View Details
C-C Motif Chemokine 27 (CCL27) Antibody
abx171967-03 1 mL

C-C Motif Chemokine 27 (CCL27) Antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human AMN (Amnion associated transmembrane protein) Full Length
MPC1516K Each

Magic™ Membrane Protein Human AMN (Amnion associated transmembrane protein) Full Length

Sign In for Pricing
View Details
OAS1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1472906 1.0 µg DNA

OAS1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details