Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q5HH26

Expression Region

1-96

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRAS40 (AKT1S1) Human Gene Knockout Kit (CRISPR)
KN400919 1 Kit

PRAS40 (AKT1S1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat VWF (Von Willebrand Factor) CLIA Kit
E-CL-R0694-01 24 Tests

Rat VWF (Von Willebrand Factor) CLIA Kit

Sign In for Pricing
View Details
Rat VWF (Von Willebrand Factor) CLIA Kit
E-CL-R0694-02 48 Tests

Rat VWF (Von Willebrand Factor) CLIA Kit

Sign In for Pricing
View Details
Rat VWF (Von Willebrand Factor) CLIA Kit
E-CL-R0694-03 96 Tests

Rat VWF (Von Willebrand Factor) CLIA Kit

Sign In for Pricing
View Details
Tau (MAPT) Human Gene Knockout Kit (CRISPR)
KN213312LP 1 Kit

Tau (MAPT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SNF5 (SMARCB1) Human Gene Knockout Kit (CRISPR)
KN217885RB 1 Kit

SNF5 (SMARCB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details