Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q5HH26

Expression Region

1-96

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ɑ-Biotinamido-ω-Mercaptopropanamido PEG
1310000-25-4.500MG 500 mg

Ɑ-Biotinamido-ω-Mercaptopropanamido PEG

Sign In for Pricing
View Details
ATP6V1E1 (NM_001696) Human Over-expression Lysate
LC419796 20 µg

ATP6V1E1 (NM_001696) Human Over-expression Lysate

Sign In for Pricing
View Details
Peroxiredoxin 4 (PRDX4) Rabbit Polyclonal Antibody
TA367521 100 µL

Peroxiredoxin 4 (PRDX4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pre-Vitamin D3 Decanoate (>80%)
TRC-P927820-5MG 5 mg

Pre-Vitamin D3 Decanoate (>80%)

Sign In for Pricing
View Details
Carboxylated - 96 well Solid plates - White PS
MCW04F-COOH 10x 96 Well Plates

Carboxylated - 96 well Solid plates - White PS

Sign In for Pricing
View Details
Argininosuccinate Lyase (ASL) (NM_000048) Human Over-expression Lysate
LC424953 20 µg

Argininosuccinate Lyase (ASL) (NM_000048) Human Over-expression Lysate

Sign In for Pricing
View Details