Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q5HQB2

Expression Region

1-96

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTIVKHTVGFIASIVLTLLAVFVTLYTNMTFHAKVTIIFGFAFIQAALQLLMFMHLTEG KDGRLQSFKVIFAIIITLVTVIGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXA2 Human Gene Knockout Kit (CRISPR)
KN204066 1 Kit

FOXA2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dianhydrodaunomycinone
TRC-D416618-5MG 5 mg

Dianhydrodaunomycinone

Sign In for Pricing
View Details
CF®498 Donkey Anti-Mouse IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL
#20994-50uL 1x 50 µL

CF®498 Donkey Anti-Mouse IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL

Sign In for Pricing
View Details
TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI4E4]
CF813028 100 µg

TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI4E4]

Sign In for Pricing
View Details
2-Thenoic Acid
TRC-T343505-10G 10 g

2-Thenoic Acid

Sign In for Pricing
View Details
GLI1 Rabbit Polyclonal Antibody
TA367582 100 µL

GLI1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details