Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q5HQB2

Expression Region

1-96

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTIVKHTVGFIASIVLTLLAVFVTLYTNMTFHAKVTIIFGFAFIQAALQLLMFMHLTEG KDGRLQSFKVIFAIIITLVTVIGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSIG1 (NM_182607) Human Over-expression Lysate
LY403639 100 µg

VSIG1 (NM_182607) Human Over-expression Lysate

Sign In for Pricing
View Details
CACNA1G Mouse Monoclonal Antibody [Clone ID: N178A/9]
75-206 100 µL

CACNA1G Mouse Monoclonal Antibody [Clone ID: N178A/9]

Sign In for Pricing
View Details
SLAMF7 Rabbit Polyclonal Antibody
TA364444 100 µL

SLAMF7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RASGRF1 Human Gene Knockout Kit (CRISPR)
KN415382 1 Kit

RASGRF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
AN00429UD-01 25 µg

PE Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]

Sign In for Pricing
View Details
PE Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
AN00429UD-02 100 µg

PE Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]

Sign In for Pricing
View Details