Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6A Uncharacterized protein U91 (U91)

This Recombinant Human herpesvirus 6A Uncharacterized protein U91 (U91) spans the amino acid sequence from region 19-114.

Product Specifications

Product Name Alternative

Uncharacterized protein U91

UniProt

Q69569

Expression Region

19-114

Origin

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KNEKKNITDGLFLDSVTSQAMENKESMKKNEGEPPVWIQALTTTLSIILLVCIIMACIIC SRTTEEEKSEMQSSASSVETLQSLNEAIFPKGEMNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRAS (NM_004985) Human Recombinant Protein
PH41122M5 20 µg

KRAS (NM_004985) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Monoclonal ING5 Antibody (119) [mFluor Violet 450 SE]
NBP2-90261MFV450 0.1 mL

Rabbit Monoclonal ING5 Antibody (119) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
GRIK2 Rabbit pAb, Pacific Blue conjugated
orb2827111 100 µL

GRIK2 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
RBM45 Double Nickase Plasmid (h)
sc-406889-NIC 20 µg

RBM45 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
LOC681996 Protein Vector (Rat) (pPB-C-His)
PV279138 500 ng

LOC681996 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
GPR139 Adenovirus (Mouse)
22507054 1.0 mL

GPR139 Adenovirus (Mouse)

Sign In for Pricing
View Details