Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6A Uncharacterized protein U91 (U91)

This Recombinant Human herpesvirus 6A Uncharacterized protein U91 (U91) spans the amino acid sequence from region 19-114.

Product Specifications

Product Name Alternative

Uncharacterized protein U91

UniProt

Q69569

Expression Region

19-114

Origin

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KNEKKNITDGLFLDSVTSQAMENKESMKKNEGEPPVWIQALTTTLSIILLVCIIMACIIC SRTTEEEKSEMQSSASSVETLQSLNEAIFPKGEMNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACADVL Rabbit Polyclonal Antibody (Fluoro647)
orb3079686 100 µg

ACADVL Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
CIP2A Antibody [J4B12]
C21215-50uL 50 μL

CIP2A Antibody [J4B12]

Sign In for Pricing
View Details
Lentiviral mouse Cidec shRNA (UAS) - Lentiviral mouse Cidec shRNA (UAS, iRFP) plasmid
GTR15273748 1 Vial

Lentiviral mouse Cidec shRNA (UAS) - Lentiviral mouse Cidec shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Mal-PEG-NH2.HCl, 4K
HE022050-4K-01 1 g

Mal-PEG-NH2.HCl, 4K

Sign In for Pricing
View Details
Mal-PEG-NH2.HCl, 4K
HE022050-4K-02 5 g

Mal-PEG-NH2.HCl, 4K

Sign In for Pricing
View Details
Anti-DAAM1 Antibody
A05163-2 100 µL

Anti-DAAM1 Antibody

Sign In for Pricing
View Details