Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6A Uncharacterized protein U91 (U91)

This Recombinant Human herpesvirus 6A Uncharacterized protein U91 (U91) spans the amino acid sequence from region 19-114.

Product Specifications

Product Name Alternative

Uncharacterized protein U91

UniProt

Q69569

Expression Region

19-114

Origin

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KNEKKNITDGLFLDSVTSQAMENKESMKKNEGEPPVWIQALTTTLSIILLVCIIMACIIC SRTTEEEKSEMQSSASSVETLQSLNEAIFPKGEMNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CFTR Antibody [Alexa Fluor 405]
NBP2-41265AF405 0.1 mL

Rabbit Polyclonal CFTR Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Di-n-Butyl Phosphorochloridate
TRC-D429450-5G 5 g

Di-n-Butyl Phosphorochloridate

Sign In for Pricing
View Details
DHX29 Rabbit pAb, PE-Cy7 conjugated
orb2866921 100 µL

DHX29 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
BAK/BAK1 Mouse Monoclonal Antibody (HRP)
orb2609084 100 µg

BAK/BAK1 Mouse Monoclonal Antibody (HRP)

Sign In for Pricing
View Details
Anti-TPD52L1 / D53 antibody
STJ71302 100 µg

Anti-TPD52L1 / D53 antibody

Sign In for Pricing
View Details
Rabbit Polyclonal CCDC97 Antibody
NBP2-87155 100 µL

Rabbit Polyclonal CCDC97 Antibody

Sign In for Pricing
View Details