Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q6GAF5

Expression Region

1-96

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCR4 (Chemokine (C-X-C Motif) Receptor 4, CD184, D2S201E, FB22, HM89, HSY3RR, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM) (MaxLight 490)
245118-ML490 100 µL

CXCR4 (Chemokine (C-X-C Motif) Receptor 4, CD184, D2S201E, FB22, HM89, HSY3RR, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM) (MaxLight 490)

Sign In for Pricing
View Details
Ertapenem N-Isobutoxycarbonyl O- (4-Nitrobenzyl)
448398-01 250 µg

Ertapenem N-Isobutoxycarbonyl O- (4-Nitrobenzyl)

Sign In for Pricing
View Details
Ertapenem N-Isobutoxycarbonyl O- (4-Nitrobenzyl)
448398-02 1 mg

Ertapenem N-Isobutoxycarbonyl O- (4-Nitrobenzyl)

Sign In for Pricing
View Details
CD43 (T Cell Marker, Leukosialin, Sialophorin, or Leukocyte Sialoglycoprotein) (FITC)
MBS6125303-01 0.1 mL

CD43 (T Cell Marker, Leukosialin, Sialophorin, or Leukocyte Sialoglycoprotein) (FITC)

Sign In for Pricing
View Details
CD43 (T Cell Marker, Leukosialin, Sialophorin, or Leukocyte Sialoglycoprotein) (FITC)
MBS6125303-02 5x 0.1 mL

CD43 (T Cell Marker, Leukosialin, Sialophorin, or Leukocyte Sialoglycoprotein) (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal SMC2 Antibody [DyLight 755]
NB100-373IR 100 µL

Rabbit Polyclonal SMC2 Antibody [DyLight 755]

Sign In for Pricing
View Details