Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q6GAF5

Expression Region

1-96

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duck Histone H1.2 (HIST1H1C) ELISA Kit
MBS9920439 Inquire

Duck Histone H1.2 (HIST1H1C) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal KIR2DL1/KIR2DS5 Antibody (124) [DyLight 488]
NBP2-90181G 0.1 mL

Rabbit Monoclonal KIR2DL1/KIR2DS5 Antibody (124) [DyLight 488]

Sign In for Pricing
View Details
TMEM165 Antibody
A36814-50UG 50 µg

TMEM165 Antibody

Sign In for Pricing
View Details
TRB-3 (Tribbles Homolog 3, Neuronal Cell death-inducible Putative Kinase, SINK, p65-interacting Inhibitor of NF-kappaB)
MBS6001176-01 0.1 mg

TRB-3 (Tribbles Homolog 3, Neuronal Cell death-inducible Putative Kinase, SINK, p65-interacting Inhibitor of NF-kappaB)

Sign In for Pricing
View Details
TRB-3 (Tribbles Homolog 3, Neuronal Cell death-inducible Putative Kinase, SINK, p65-interacting Inhibitor of NF-kappaB)
MBS6001176-02 5x 0.1 mg

TRB-3 (Tribbles Homolog 3, Neuronal Cell death-inducible Putative Kinase, SINK, p65-interacting Inhibitor of NF-kappaB)

Sign In for Pricing
View Details
NIM1K (NM_153361) Human Over-expression Lysate
LH14858V 100 µg

NIM1K (NM_153361) Human Over-expression Lysate

Sign In for Pricing
View Details