Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus PsbF-like protein (Pro_1494)

This Recombinant Prochlorococcus marinus PsbF-like protein (Pro_1494) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

PsbF-like protein

UniProt

Q7VAG9

Expression Region

1-96

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLKTLIVIAPILIAAFSTIFWLSYWGVFKWEDNQLGFENYQDWEDSGVIPENRPKGGYP VFTVRTLAVNALGIPTVFFLGAIFAMQFVRRGIFIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Lipocalin-2/NGAL Antibody (10) [DyLight 650]
NBP2-21746C 0.1 mL

Mouse Monoclonal Lipocalin-2/NGAL Antibody (10) [DyLight 650]

Sign In for Pricing
View Details
3110009E18Rik (NM_028439) Mouse Recombinant Protein
TP500668 20 µg

3110009E18Rik (NM_028439) Mouse Recombinant Protein

Sign In for Pricing
View Details
PAAV-CAG-EGFP-HA Plasmid
PVT82813 2 µg

PAAV-CAG-EGFP-HA Plasmid

Sign In for Pricing
View Details
ELOVL5 Blocking Peptide
CBP4631-01 1 mg

ELOVL5 Blocking Peptide

Sign In for Pricing
View Details
ELOVL5 Blocking Peptide
CBP4631-02 5 mg

ELOVL5 Blocking Peptide

Sign In for Pricing
View Details
ARPIN Polyclonal Antibody, FITC Conjugated
A65912-100 100 µL

ARPIN Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details