Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus PsbF-like protein (Pro_1494)

This Recombinant Prochlorococcus marinus PsbF-like protein (Pro_1494) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

PsbF-like protein

UniProt

Q7VAG9

Expression Region

1-96

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLKTLIVIAPILIAAFSTIFWLSYWGVFKWEDNQLGFENYQDWEDSGVIPENRPKGGYP VFTVRTLAVNALGIPTVFFLGAIFAMQFVRRGIFIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CHRNE Protein, His (Fc)-Avi-tagged
CHRNE-1671M 50 µg

Recombinant Mouse CHRNE Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Upk1b sgRNA CRISPR Lentivector (Rat) (Target 3)
K6755804 1.0 µg DNA

Upk1b sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Hoxd4 (NM_001105885) Rat Tagged ORF Clone Lentiviral Particle
RR212994L4V 200 µL

Hoxd4 (NM_001105885) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TRIM39 Antibody (Center)
orb1936667-01 50 µL

TRIM39 Antibody (Center)

Sign In for Pricing
View Details
TRIM39 Antibody (Center)
orb1936667-02 100 µL

TRIM39 Antibody (Center)

Sign In for Pricing
View Details
Thyroglobulin (Tg) (MaxLight 490)
MBS6204351-01 0.1 mL

Thyroglobulin (Tg) (MaxLight 490)

Sign In for Pricing
View Details