Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus PsbF-like protein (Pro_1494)

This Recombinant Prochlorococcus marinus PsbF-like protein (Pro_1494) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

PsbF-like protein

UniProt

Q7VAG9

Expression Region

1-96

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLKTLIVIAPILIAAFSTIFWLSYWGVFKWEDNQLGFENYQDWEDSGVIPENRPKGGYP VFTVRTLAVNALGIPTVFFLGAIFAMQFVRRGIFIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Decane, 5-methyl-
orb1986166-01 100 mg

Decane, 5-methyl-

Sign In for Pricing
View Details
Decane, 5-methyl-
orb1986166-02 500 mg

Decane, 5-methyl-

Sign In for Pricing
View Details
TREM1 Polyclonal Antibody
MBS2562128-01 0.02 mL

TREM1 Polyclonal Antibody

Sign In for Pricing
View Details
TREM1 Polyclonal Antibody
MBS2562128-02 0.06 mL

TREM1 Polyclonal Antibody

Sign In for Pricing
View Details
TREM1 Polyclonal Antibody
MBS2562128-03 0.12 mL

TREM1 Polyclonal Antibody

Sign In for Pricing
View Details
TREM1 Polyclonal Antibody
MBS2562128-04 0.2 mL

TREM1 Polyclonal Antibody

Sign In for Pricing
View Details