Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q7A6A1

Expression Region

1-96

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RARG Protein Vector (Rat) (pPB-N-His)
PV298179 500 ng

RARG Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Anti-DHODH Polyclonal Antibody
PHF91801 100 μg

Anti-DHODH Polyclonal Antibody

Sign In for Pricing
View Details
5- (1,3-Dioxo-2,3-dihydro-1H-isoindol-2-yl) pentanoic acid
BAA14776-01 100 mg

5- (1,3-Dioxo-2,3-dihydro-1H-isoindol-2-yl) pentanoic acid

Sign In for Pricing
View Details
5- (1,3-Dioxo-2,3-dihydro-1H-isoindol-2-yl) pentanoic acid
BAA14776-02 1 g

5- (1,3-Dioxo-2,3-dihydro-1H-isoindol-2-yl) pentanoic acid

Sign In for Pricing
View Details
rac-Synephrine
TRC-S920000-5G 5 g

rac-Synephrine

Sign In for Pricing
View Details
CXorf30 siRNA Oligos set (Human)
17196171 3x 5 nmol

CXorf30 siRNA Oligos set (Human)

Sign In for Pricing
View Details