Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase polypeptide IV

UniProt

Q7A6A1

Expression Region

1-96

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETV4 (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (MaxLight 550)
126482-ML550 100 µL

ETV4 (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (MaxLight 550)

Sign In for Pricing
View Details
Rat TYR (Tyrosinase) ELISA Kit
RE1972R-01 48 Tests

Rat TYR (Tyrosinase) ELISA Kit

Sign In for Pricing
View Details
Rat TYR (Tyrosinase) ELISA Kit
RE1972R-02 96 Tests

Rat TYR (Tyrosinase) ELISA Kit

Sign In for Pricing
View Details
Olr879 Protein Vector (Rat) (pPM-C-His)
PV291465 500 ng

Olr879 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal OPA3 Antibody (OTI3G4) [Alexa Fluor 750]
NBP2-73147AF750 0.1 mL

Mouse Monoclonal OPA3 Antibody (OTI3G4) [Alexa Fluor 750]

Sign In for Pricing
View Details
HOOK1 Rabbit pAb
MBS8548238-01 0.1 mL

HOOK1 Rabbit pAb

Sign In for Pricing
View Details